Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

4j10





4j10 (red) and 1uf7 (white)


PDBID: 4j10

Motif: 1uf7

EC # of Motif: 3.5.1.77
 
Motif Homolog: 1fo6

Levenshtein Distance: 0 

RMSD All: 1.9419 Å

RMSD CA: 1.9274 Å

RMSD CA+CB: 1.6336 Å

Residues: (3)
 4j101uf7 
 Glu-12 Glu-46
Lys-77Lys-126
 Ala-80 Ala-171


4j10 FASTA: 
    SNAMAEIKITPEELERIAGNFKNAAGEAQSQINRLEGDINSLEGQWAGATQA KFRGEFIQSKQAMQQYIPILEGISTDLKRIADKFRNTDNAY