Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

4ils


PDBID: 4ils

Motif: 1c8v

EC # of Motif: 4.2.1.20
 
Motif Homolog: 1a50

Levenshtein Distance: 0 -1

RMSD All: 3.93466 Å

RMSD CA: 2.21848 Å

RMSD CA+CB2.08884 Å

Residues: (4)
 4ils1c8v 
His-296His-86 
 Lys-303 Lys-87
 Lys-338Lys-167 
 Asp-344Asp-305
                                         4ils (red) and 1c8v (white)



4ils FASTA:
   MNDFHRDTWAEVDLDAIYDNVENLRRLLPDDTHIMASVCGNAYGHGDVQVARTALEAGASRLAVAFLDEAL
    ALREKGIEAPILVTGASRPADAALAAQQRIALTVFRSDWLEEASALYSGPFPIHFHLYMDTGMGSLGVKDEEETKRI
    VALIERHPHFVLEGLWTWFATADEVNTDYFSYQYTRFLHMLEWLPSRPPLVFCANSAASLRFPDRTFNMVQFGIA
    MYGLAPSPGIKPLLPYPLKEAFSLHSRLVHVKKLQPGEKVSYGATYTAQTEEWIGTIPIGYKDGWLRRLQHFHVLVD
    GQKAPIVGRILMDMCMIRLPGPLPVGTKVTLIGRQGDKVISIDDVARHLETINYEVPCTISYRVPRIFFRHKRIMEVR
    NAIGRGESSAGS