Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

4hwm

4hwm (red) and 1foh (white)



PDBID: 4hwm

Motif: 1foh

EC # of Motif: 1.14.13.7
 
Motif Homolog: 1pn0

Levenshtein Distance: 0-1

RMSD All: 2.1996 Å

RMSD CA1.18866 Å

RMSD CA+CB1.5971 Å

Residues: (3)
 4hwm    1foh 
 Asp-67  Asp-55 
Arg-69 Arg-281 
Tyr-109 Tyr-289 
  Pro-365

4hwm FASTA:
    GGCVQVDRYEDVVKAPAPAGLAGFWQTKGPQSAMMSPDAIASLIVTKEGDTF
    DCRQWQRVIAQPGKLMNRDSEIYNVTASLDIYPVEREGNTISYDRMTLSRVERL
    TPECEKAWAKARATGPVSAPASTR