Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

4ghb

4ghb (red) and 1pno (white)

PDB: 4ghb

Motif:1pno

EC # of Motif: 1.6.1.2

Motif Homolog: 1dil

Levenshtein Distance: 0

RMSD All: 1.7504 Å

RMSD CA: 1.0389 Å

RMSD CA+CB: 0.8509 Å

Residues: (3)

 4ghb1pno 
Tyr-57 Tyr-316
Arg-91 Arg-352 
Tyr-118 Tyr-432 

4ghb FASTA:
    GDDNNGSDTPEPEPSTYPTTPFSKIELKEVIESDAQPVTATHTYLYNSAGRL
    TGYTGKQSFTAGDELFEIENTTTVEYKDHQAVITDEAGTVSTYTLNDKGYA
    TTCTSQDMAGNTRTYTFSYLINTEDKYYLENITEKLDDGKEYSFITIDYSNFR
    ALRIQQKVDTFEHNSTATTPSGNEIANISEIPSLFITDMYPLSMHAVAIYGKIL
    GEPANYLITQLIPDSNGESEETTTYTYTLDNRGIVTSCHAVVRHIRNGYEQD
    YTRTVNYTIE