Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

4ezi


4ezi (red) and 1orv (white)


PDBID: 4ezi

Motif: 1orv

EC # of Motif: 3.4.14.5
 
Motif Homolog: 1pfq

Levenshtein Distance: 0

RMSD All: 0.3579 Å

RMSD CA0.212 Å

RMSD CA+CB0.1878 Å

Residues: (3)

 4ezi1pfq 
Ser-195 Ser-630 
Asp-344 Asp-708 
His-377 His-740 




4ezi (red) and 1h2x (white)



Motif: 1h2x

EC # of Motif: 3.4.21.26

Motif Homolog: 1qfm

Levenshtein Distance: 0 

RMSD All: 0.4389 Å

RMSD CA0.3137 Å

RMSD CA+CB0.1887 Å

Residues: (3)

 4ezi1h2x 
Ser-195 Ser-554 
Asp-344 Asp-641 
 His-377His-680 



4ezi FASTA: 
    GALEHEKLVNYIALGEFSRETAEIALKKMPPLDTLTVHYDLQLYKINYKT
    QSPDGNLTIASGLVAMPIHPVGQVGIISYHGTRFERNDVPSRNNEKNYIY
    LAAYGNSAGYMTVMPDYLGLGDNELTLHPYVQAETLASSSIDMLFAAK
    ELANRLHYPISDKLYLAGYSEGGFSTIVMFEMLAKEYPDLPVSAVAPGSA
    PYGWEETMHFVMLEPGPRATAYLAYFFYSLQTYKSYWSGFDEIFAPPYNT
    LIPELMDGYHAVDEILQALPQDPLLIFQPKFSNGIISKTDRNTEILKINFNH
    YDFKPTAPLLLVGTKGDRDVPYAGAEMAYHSFRKYSDFVWIKSVSDALD
    HVQAHPFVLKEQVDFFKQFERQEAMNK