Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

4e2t

4e2t (red) and 1mbb (white)



PDBID: 4e2t

Motif: 1mbb

EC # of Motif: 1.1.1.158
 
Motif Homolog: 1hsk

Levenshtein Distance: 0-2

RMSD All: 2.4993 Å

RMSD CA1.8004 Å

RMSD CA+CB1.8505Å

Residues: (3)

4e2t 1mbb 
 Arg-4Arg-159 
Ser-20 Ser-229 
Glu-22 Glu-325 



4e2t FASTA:
    AFARDTEVYYENDTVPHMESIEEMYSKYASMNGELPFDNGYAVPLDNVF
    VYTLDIASGEIKKTRASYIYREKVEKLIEIKLSSGYSLKVTPSHPVLLFRDGLQ
    WVPAAEVKPGDVVVGVREEVLRRRIISKGELEFHEVSSVRIIDYNNWVYDL
    VIPETHNFIAPNGLVLHNAQ