Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

4diu


4diu (red) and 1azw (white)


PDBID: 4diu 

Motif: 1azw

EC # of Motif: 3.4.11.5
 
Motif Homolog: 1xqw

Levenshtein Distance: 0

RMSD All: 0.4698 Å

RMSD CA0.16 Å

RMSD CA+CB0.3215 Å

Residues: (3)

 4diu1azw 
 Ser-93Ser-110 
His-192  Trp-111
His-222 Asp-266 
 His-294 


4diu FASTA:
    MKIVPPKPFFFEAGERAVLLLHGFTGNSADVRMLGRFLESKGYTCHAPIYSGHGVPPEALTRFGPEAWWQDV
    MNGYEFLKNKGYEKIAVAGLSLGGVFSLKLGYTVPIEGIVTMCAPMYIKSEETMYEGVLEYAREYKKREGKSEE
    QIEQEMEKFKQTPMLTLKALQELIADVRDHLDLIYAPTFVVQARHDEMINPDSANIIYNEIESPVKQIKWYEQ
    SGHVITLDQEKDQLHEDIYAFLESLDWLE