Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

3ups

3ups (red) and 1kkt (white)


PDBID: 3ups

Motif: 1kkt

EC # of Motif: 3.2.1.113
 
Motif Homolog: 1dl2

Levenshtein Distance: 0-9

RMSD All: 3.3377 Å

RMSD CA1.9366 Å

RMSD CA+CB1.9229 Å

Residues: (4)

3ups 1kkt 
Asp-70 Glu-122 
Arg-71 Arg-126 
Glu-83 Asp-267 
Asp-94 Glu-409 

3ups FASTA:
    SNAMPAPSSPRKNQTSFDPEMLLKLVTDSLDDDQALEIATIPLAGKSSIADYMVIASGRSSRQVTAMAQKL
    ADRIKAATGYVSKIEGLPAADWVLLDAGDIIIHLFRPEVRSFYNLERMWGFGDESDQPVSQSVLS