Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

3tb2

3tb2 (red) and 1k9z (white)

PDBID: 3tb2

Motif: 1k9z

EC # of Motif: 3.1.3.7
 
Motif Homolog: 2wef

Levenshtein Distance: 1-5

RMSD All: 2.0676 Å

RMSD CA1.43 Å

RMSD CA+CB1.3867 Å

Residues: (3)

 3tb21k9z 
 Chain AChain A 
 Asp-120Asp-49 
 Thr-122Thr-147 
 Chain BChain A 
 Asp-120Asp-294 
 Thr-122 

3tb2 FASTA:
    MGYHLGATFPNFTAKASGIDGDFELYKYIENSWAILFSHPNDFTPVCTTELAELGKMHEDFLKLNCKLIGFSCN
    SKESHDKWIEDIKYYGKLNKWEIPIVCDESRELANKLKIMDEQEKDITGLPLTCRCLFFISPEKKIKATVLYPATTG
    RNAHEILRVLKSLQLTYTTPVATPVNWNEGDKCCVIPTLQDDEISKHFKNEITKVEMPSKKKYLRFVNL