Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

3s5e

3s5e (red) and 1aw5 (white)


PDBID: 3s5e

Motif: 1aw5

EC # of Motif: 4.2.1.24
 
Motif Homolog: 1h7o

Levenshtein Distance: 1

RMSD All: 1.9804 Å

RMSD CA0.9718 Å

RMSD CA+CB0.9793 Å

Residues: (3)

3s5e 1aw5 
 Asp-299Asp-131 
 Ser-201Ser-179 
Lys-208 Lys-263 


325e FATSA: 
    GTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVIN
    KQTPNKQIRLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA