Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

3re2

3re2 (red) and 1opm (white)


PDBID: 3re2

Motif: 1opm

EC # of Motif: 1.14.17.3
 
Motif Homolog: 1phm

Levenshtein Distance: 0-1

RMSD All: 2.3669 Å

RMSD CA1.8409 Å

RMSD CA+CB1.8359 Å

Residues: (3)

 3re21opm 
His-340 His-108 
Asn-344 Gln-170 
His-398 His-242 


3re2 FASTA: 
    GPAMAGKSIPFPLKDIKSVVEVFRQELRNDQPNLAQLSIVLGFFESASTMKAGDTTSTPSLDEETFDALHCKFM
    ALLQRDFTFNAGGLPATREIVKNVADLVWGCLAKSYFKDRPHIQNLYSFLTGNRLDCFGVAFAVVAMCQAL
    GYNDVHLALSEDHAWVVFGKDKIETAEVTWHGKGNEDKRGKPVIYQDDDRCSWLYLNGNAVHCTRHMEV
    ASIISSINPNINHTTDSIQLSQLQQELLWLLYDMGHIKTYPMAIANLGDLEEISPTPGRPPAEELFKEAITVAKREY
    SDHHIYPYTYLGGYYYRKKKYYEAIASWVDAGYVAGKYNYSKDDEEMYKEFHEIANDLIPNILKDAVAKADPS
    GTGSTNLTSDPKFFALVLQFYDGICLWEEGSPTPVLHADWAKKLVQSIGKFAPECRSAFNANTDTLSLRSAKM
    REMKNLITTSGKLNTSAMKLQLTAQSQVNVPKSRR