Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

3rby

3rby (red) and 1bk7 (white)


PDBID: 3rby

Motif: 1bk7

EC # of Motif: 3.1.27.1
 
Motif Homolog: 1bol

Levenshtein Distance: 0-3

RMSD All: 2.1503 Å

RMSD CA0.6621 Å

RMSD CA+CB1.2989 Å

Residues: (3)

3rby1bk7 
His-340 His-108 
Asn-344 Gln-170 
His-398 His-242 


3rby FASTA: 
    HMPALLKRLLFQVGPHPNERTFTLSSVSTDGHYISLRPFVKPSGDELSFPFEWAFAGTNETVKAND
    QGNGVVTQDFNFWLDTNVYLNVPNTHRGEVNTTWKNWDSGCVEETGAVYPFGADKESVSFRE
    MWQPVDPSREDLVIVSPNNEKFSSNARSIVLKVTDEAYDGLVIVIGRWIQGFLSQKNNNTIEGLNF
    IRLLEKDSGKSEFLLSYGKEVNKIPQSYENLKKGSTVTSNGLNWEV