Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

3q9d



NEED IMAGE
3q9d (red) and 1ezr (white)


PDBID: 3q9d

Motif: 1ezr

EC # of Motif: N/A
 
Motif Homolog: N/A

Levenshtein Distance: 0

RMSD All: 1.9872 Å

RMSD CA3.5646 Å

RMSD CA+CB3.0354 Å

Residues: (3)

3q9d 1ezr 
Asp-134 Asp-10 
Asn-137 Asn-168 
His-140 His-240 


3q9d FASTA:
    MSYYHHHHHHLESTSLYKKAGLDYDIPTTENLYFQGMAAKTKTLELEDNVFLLLEGNLKRIFATPIGYT
    TFREFQNVVFNCANGQQEIANFFFEMLINGKLTQELAPQQKQAAHSLIAEFMMPIRVAKDIHERGEFI
    NFITSDMLTQQERCIFLNRLARVDGQEFLLMTDVQNTCHLIRHLLARLLEAQKNPVGEKNLQEIQEEI
    TSLKNHFDELTKALQ