Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

3nrn

PDBID: 3nrn

Motif: 1qam

EC # of Motif: 2.1.1.184
 
Motif Homolog: 1yub

Levenshtein Distance: 0

RMSD All: 0.391 Å

RMSD CA0.8013 Å

RMSD CA+CB1.0185 Å

Residues: (3)

 3nrn1qam 
 Gly-7Gly-38 
 Glu-30Glu-59 
 Asn-238Asn-101 



                                                                  

                                                          3nrn (red) and 1qam (white)

3nrn FASTA: 
    SNAVGTGGDKAYCVVVDGMGGMIRGDEAAQRALSASVGVLDAGGSPLDAVLAAQAAVHRWASQG
    GILGRTGATMAVAAVNLRDGTLEWASVGDCRVYLFKGGRLSRLSLDHNVSSEMVLLGRGPVPGPAGE
    MITSFIGIENLTEISTSEAPLPLEAGEGVLVVSDGVYRSLHEDRIAMALSRGSDARGILQEVEAQGRPYQD
    NATLALVIL