Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

3nlc


3nlc (red) and 1bmt (white)

PDBID: 3nlc

Motif: 1bmt

EC # of Motif: 2.1.1.13
 
Motif Homolog: N/A

Levenshtein Distance: 0

RMSD All: 1.5429 Å

RMSD CA0.9762 Å

RMSD CA+CB0.9626 Å

Residues: (3)

 3nlc1bmt 
 Asp-166Asp-757 
 His-203His-759 
 Ser-357Ser-810 


3nlc FASTA: 
    MGHHHHHHSHMIRINEIKLPLDHEEGALLDAITKKLGIPAEKVISFNVFRRGYDARKKTNIHLIYTLDIIVEGDE
    TALLAKFANDPHVRQTPDMEYKFVAKAPENLTERPIVIGFGPCGLFAGLVLAQMGFNPIIVERGKEVRERTKDT
    FGFWRKRTLNPESNVQFGEGGAGTFSDGKLYSQVKDPNFYGRKVITEFVEAGAPEEILYVSKPHIGTFKLVTMI
    EKMRATIIELGGEIRFSTRVDDLHMEDGQITGVTLSNGEEIKSRHVVLAVGHSARDTFEMLHERGVYMEAKPF
    SVGFRIEHKQSMIDEARFGPNAGHPILGAADYKLVHHCKNGRTVYSFCMCPGGTVVAATSEEGRVVTNGMS
    QYSRAERNANSAIVVGISPEVDYPGDPLAGIRFQRELESNAYKLGGENYDAPAQKIGDFLKGRDPSQLGDVEP
    SFTPGIKLTDLSKALPPFAVEAIREAIPAFDRKIKGFASEDGLLTGVETRTSSPVCIKRGKDFQSVNLKGFYPAGE
    GAGYAGGILSAGIDGIKVAEAVARDIVAAMENA