Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

3m3i


3m3i (red) and 4hoh (white)

PDBID: 3m3i

Motif: 4hoh

EC # of Motif: 3.1.27.3
 
Motif Homolog: 1b2m

Levenshtein Distance: 0-21

RMSD All: 2.6934 Å

RMSD CA2.3834 Å

RMSD CA+CB2.7432 Å

Residues: (3)

 3m3i4hoh 
His-25 His-40 
Glu-27 Glu-58 
His-68 His-92 


3m3i FASTA:
    MAHHHHHHMTSPALAPPQNTAEFWIKRLQLVPHPEGGYYSEVVRSAHKVDNEEGNRRHAYTTIYFL
    CTPESPSHLHRLCSDETWMYHAGDPLQLHVILKDPQDEDRIAAQPPAAPQAETDTADARPKYQVYR
    RVLVGARVERGELLQYTVPGGAIFGSSVAADGADGQAGYSLVSCIVSPGFDYRDFEIFTQAQLMELY
    PQHEAVIKQMAYETLPNHARLQTTEI