Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

3l6i

3l6i (red) and 1c4x (white)

PDBID: 3l6i

Motif: 1c4x

EC # of Motif: 3.7.1.8
 
Motif Homolog: 2oq1

Levenshtein Distance: 0

RMSD All: 2.1418 Å

RMSD CA1.5767 Å

RMSD CA+CB1.3749 Å

Residues: (3)

 3l6i1c4x 
 Ser-35Ser-110 
Asp-37 Asp-235 
His-47 His-263 


3l6i FASTA:
    HHHSHMNQLTQYTITEQEINQSLAKHNNFSKDIGLPGVADAHIVLTNLTSQIGREEPNKVTLTGD
    ANLDMNSLFGSQKATMKLKLKALPVFDKEKGAIFLKEMEVVDATVQPEKMQTVMQTLLPYLNQA
    LRNYFNQQPAYVLREDGSQGEAMAKKLAKGIEVKPGEIVIPFTDLEHHHHHH