Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

3l1w


PDBID: 3l1w

Motif: 1ako

EC # of Motif: 3.1.11.2
 
Motif Homolog: N/A

Levenshtein Distance: 0-25

RMSD All: 0.2509 Å

RMSD CA0.1633 Å

RMSD CA+CB0.1709 Å

Residues: (5)  

 3l1w1ako 
 Asn-7Asn-7 
 Asp-166Asn-151 
 Asp-168Asn-153 
 Asp-215Asp-229
 His-242 His-259



                                                        3l1w (red) and 1ako (white)

3l1w FASTA:
    MKIATYNVRVDTEYDQDWQWSFRKEAVCQLINFHDWSLCCIQEVRPNQVRDLKAYTTFTCLSAEREGDGQG
    EGLAILYNEQKVQAIDTGYFWLSETPQQPSIHPEAGCPRIALWGLFKETTQNTPFLVINVHLDHISAHARLAGM
    TVILEELHDKIAQYPTLLMGDFNAESGEEVHQLVQKKFQDSKNLATHYGPRGTFQNFTYTKPWAELEEIDYIYV
    KGWQVQQTASLTDSIDGRFPSDHFPLEAEVAGENLYFQ