Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

3kk4

3kk4 (red) and 1k9z (white)


PDBID: 3kk4

Motif: 1k9z

EC # of Motif: 3.1.3.7
 
Motif Homolog: 1qgx

Levenshtein Distance: 1-2

RMSD All: 2.6181 Å

RMSD CA0.9291 Å

RMSD CA+CB1.498 Å

Residues: (3)  

 3kk41k9z 
 Asp-37Asp-49 
Asp-94 Thr-147 
Thr-96 Asp-294 


3kk4 FASTA:
    SNAMCEIFIRANQRSYSVQARSLRLHGVATSVRLEQLFWDVLEEIAARDGMRVTQLIERLYDELV
    QYRGEAANFTSFLRVCCLRYQVLQAEGRIPADATVPIRSLDAQAVLRGLPANLYDSRPLG