Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

3hfq

3hfq (red) 1jof (white)


PDBID: 3hfq

Motif: 1jof

EC # of Motif: 5.5.1.5
 
Motif Homolog: N/A

Levenshtein Distance: 1-3 

RMSD All: 0.5619 Å

RMSD CA0.2802 Å

RMSD CA+CB0.2879 Å

Residues: (3)

 3hfq1jof 
 His-144His-148 
Arg-190 Arg-196 
Glu-206 Glu-212 


3hfq FASTA:
    MQERILFGTYTKKTSQGIYQGTLDTTAKTLTNDGLLAATQNPTYLALSAKDCLYSVDKEDDEGGIAAWQIDGQ
    TAHKLNTVVAPGTPPAYVAVDEARQLVYSANYHKGTAEVMKIAADGALTLTDTVQHSGHGPRPEQDGSHIH
    YTDLTPDNRLAVIDLGSDKVYVYNVSDAGQLSEQSVLTMEAGFGPRHLVFSPDGQYAFLAGELSSQIASLKYD
    TQTGAFTQLGIVKTIPADYTAHNGAAAIRLSHDGHFLYVSNRGYNTLAVFAVTADGHLTLIQQISTEGDFPRD
    FDLDPTEAFVVVVNQNTDNATLYARDLTSGKLSLLQKDVTVPEGVCVRFLEHHHHHH