Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

3h04

3h04 (red) and 1azw (white)

PDBID: 3h04

Motif: 1azw

EC # of Motif: 3.4.11.5
 
Motif Homolog: 1xqw

Levenshtein Distance: 0

RMSD All: 0.3416 Å

RMSD CA: 0.2104 Å

RMSD CA+CB: 0.2385 Å

Residues: (3)

 3h041azw 
Asp-220 Asp-266 
His-248 His-294 
Ser-104 Ser-110 





3h04 (red) and 1c4x (white)

Motif: 1c4x

EC # of Motif: 3.7.1.8
 
Motif Homolog: N/A

Levenshtein Distance: 0

RMSD All: 0.2802 Å

RMSD CA: 0.1259 Å

RMSD CA+CB: 0.1589 Å

Residues: (3)

3h04 1c4x 
Asp-220 Asp-235 
His-248 His-263 
Ser-104 Ser-110 




3h04 (red) and 1qfm (white)


Motif: 1qfm

EC # of Motif: 3.4.21.26
 
Motif Homolog: N/A

Levenshtein Distance: 0

RMSD All: 0.2618 Å

RMSD CA: 0.1334 Å

RMSD CA+CB: 0.1849 Å

Residues: (3)

3h04 1qfm 
Asp-220 Asp-641 
His-248 Asp-680 
Ser-104 Ser-554 



3h04 FASTA: 
    MTEIKYKVITKDAFALPYTIIKAKNQPTKGVIVYIHGGGLMFGKANDLSPQYIDILTEHYDLIQ
    LSYRLLPEVSLDCIIEDVYASFDAIQSQYSNCPIFTFGRSSGAYLSLLIARDRDIDGVIDFYGYS
    RINTEPFKTTNSYYAKIAQSINETMIAQLTSPTPVVQDQIAQRFLIYVYARGTGKWINMINIA
    DYTDSKYNIAPDELKTLPPVFIAHCNGDYDVPVEESEHIMNHVPHSTFERVNKNEHDFDRR
    PNDEAITIYRKVVDFLNAITMV