Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

3flj

3flj (red) and 1aq0 (white)

PDBID: 3flj

Motif: 1aq0

EC # of Motif: 3.2.1.73
 
Motif Homolog: 2ayh

Levenshtein Distance: 1

RMSD All: 1.8566 Å

RMSD CA1.2953 Å

RMSD CA+CB1.5396 Å

Residues: (3)

3flj 1aq0 
Glu-81 Glu-288 
Lys-78 Lys-283 
Glu-58 Glu-280 


3flj FASTA: 
    MGSDKIHHHHHHENLYFQGMHPTIARMQEVVAKGDESLIHALLAEDVRFMPPTYYKTWTGRDPVA
    AVLGHVGQVFSEFRYRRIMGEGKDWALEFQCKVGELDAVGVDLITLNEGGLIQDFEVVMRPYKTVG
    ALRDAMNARVMTDARFLKYREALS