Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

3ec6

PDBID: 3ec6

Motif: 1vzz

EC # of Motif: 5.3.3.1
 
Motif Homolog: 1ev3

Levenshtein Distance: 0

RMSD All: 2.1756 Å

RMSD CA1.6978 Å

RMSD CA+CB1.8821 Å

Residues: (3)

 3ec61vzz 
Tyr-42 Tyr-16 
Asp-88 Asp-40 
Leu-91 Asp-103 





                                                        3ec6 (red) and 1vzz (white)


3ec6 FASTA: 
    GMHLKEKITTIIQGQRTGVLSTVRNDKPHSAFMMFFHEDFVLYVATDRQSKKITDIENNPNVHV
    LLGREGKKLDEDYIEVEGLASIEEDSTLKNKFWNNSLKRWLLRPEDPNYVLIKINPDTIYYIDGAGTTEPEFLRL