Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

3d19

3d19 (red) and 1eq2 (white)

PDBID: 3d19

Motif: 1eq2

EC # of Motif: 5.1.3.20
 
Motif Homolog: N/A

Levenshtein Distance: 0-15

RMSD All: 2.0207 Å

RMSD CA1.7751 Å

RMSD CA+CB2.1176 Å

Residues: (3)

 3d191eq2 
 His-171His-107 
Lys-167 Lys-47 
Ser-188 Ser-137 


3d19 FASTA: 
    MSLDTGVTSVMFVERSLNEIRFWSRIMKEHSFFLRLGFRCEDTQLIEEANQFYRLFEHIEQIA
    HSYTNETDPEQIKRFNAEVQQAATNIWGFKRKILGLILTCKLPGQNNFPLLVDHTSREADY
    FRKRLIQLNEGKLDALPDAIIKENVFFLRIMADHAKFIGHLLDPSERKLVDTARNFSNDFDE
    LMYQAIDLESMKPQSQTAPLLDQFLDQNRVSVASLRDFKKTARDLIEQCKIKSIIHPLLAD
    HVFREADRFLEIIDMYDVHLTNIQSQPREGHHHHHH