Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

3cbw

3cbw (red) and 1bhg (white)

PDBID: 3cbw

Motif: 1bhg

EC # of Motif: 3.2.1.31
 
Motif Homolog: N/A

Levenshtein Distance: 0-15

RMSD All: 0.9377 Å

RMSD CA0.7219 Å

RMSD CA+CB0.7281 Å

Residues: (3)

 3cbw1bhg 
Glu-193 Glu-451 
Tyr-268 Tyr-504 
Glu-292 Glu-540 


3cbw FASTA:
     MSLAKPIEAHTVSPVNPNAQQTTKTVMNWLAHLPNRTENRVLSGAFGGYSHDTFSMAEADRIRSA
    TGQSPAIYGCDYARGWLETANIEDSIDVSCNGDLMSYWKNGGIPQISLHLANPAFQSGHFKTPITND
    QYKKILDSSTVEGKRLNAMLSKIADGLQELENQGVPVLFRPLHEMNGEWFWWGLTSYNQKDNERIS
    LYKQLYKKIYHYMTDTRGLDHLIWVYSPDANRDFKTDFYPGASYVDIVGLDAYFQDAYSINGYDQL
    TALNKPFAFTEVGPQTANGSFDYSLFINAIKQKYPKTIYFLAWNDEWSAAVNKGASALYHDSWTLN
    KGEIWNGDSLTPIVEEGHHHHHH