Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

2zbv

2zbv (red) and 2f61 (white)

PDBID: 2zbv

Motif: 2f61

EC # of Motif: 3.2.1.45
 
Motif Homolog: N/A

Levenshtein Distance: 0-4

RMSD All: 2.1988 Å

RMSD CA1.7998 Å

RMSD CA+CB1.8972 Å

Residues: (3)

2zbv 2f61
Glu-211 Glu-235 
Glu-260 Glu-340 
Glu-262 Glu-342 


2zbv FASTA:
    MIGFLTDWGLKSHYVGVAKAVIKRINPSAEIIDITHEVEPFNVRKASHVLYRASLDFPPSTV
    FLVVVDYGVGTSRKAIVMKTKNDQYFVAPDNGVLTVVAEEYGVAEIREIENRELFYKKNP
    SFTFHGRDIFAPVAAHLDMGLPLERVGDRLLSYEVLKMRKPVVENEKVIGEVAIVDTFGN
    VSTNIPFDLFLKLSVDFDDVVRVRVGRKEFKAAVAKAFGDVDTGELLVHPDSAGFLEIAV
    NLGDASQVLSVKEGDEIEICR