Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

2z6v


2zbv (red) and 1otg (white)

PDBID: 2z6v

Motif: 1otg 

EC # of Motif: 3.2.1.45
 
Motif Homolog: 

Levenshtein Distance: 0-4

RMSD All: 1.0922 Å

RMSD CA0.9692 Å

RMSD CA+CB0.8836 Å

Residues: (3)

 2z6v 1otg
Pro-88 Pro-2 
Phe-243 Phe-35 
 Arg-247Arg-41 


2z6v FASTA:
 MGSSHHHHHHSSGLVPAGSHMSDFDNITTADDVFKLAAQRTGLSEIDSDSWREGLALIVDEVNTS
PVFTPFGRQRVLDDATNALGRRLQVHAYIQDHPEVLDAPVERPLIVLGMPRTGTTVISYLLDQDPAR
RSLLHWQCVHPIPPASTETLRTDPRCLALLDEQRKILDAVTRAKMPLPHWEDADGPTEDMFIHNQD
FKGLSWDSFLPTDRYARWLFDEADMSSTYEYQKRYLQVLQSTAPGSWSLKMPSHSVHIEALLKVFPD
ARLIWAHRDPYKATGSLCNLWRLPQSLVMNTELLDQTEMGRLAMWQMRYHVDRPLRARERIGDER
FFHMYYHEMMRDPMDVMRRIYEWADEPLTAETEARMRNWLAHHPQDRFALNAYRLDEYGLTVEA
LQPIFAYLDTFDIELEGRP