Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

2z0j

2z0j (red) and 1mbb (white)

PDBID: 2z0j

Motif:  1mbb

EC # of Motif: 1.1.1.158
 
Motif Homolog: N/A

Levenshtein Distance: 1-2

RMSD All: 1.0438 Å

RMSD CA0.7483 Å

RMSD CA+CB0.8183 Å

Residues: (3)

 2z0j 1mbb
 Chain EChain A 
 Ser-78Arg-159 
Glu-81 Ser-229 
 Chain GChain A 
Arg-126 Glu-325 


2z0j FASTA:
     MRLRVDVIPGEHLAYPDVVLVVDVIRATTTAAAFLEAGAEALYWTPSLESALAFKDEDVVLAGETGGLKPPRFD
    LGNSPREALSAQVAGRVVVMSTTNGTKAAHAAARTAKHVLLASLYNAHAAARLARELATEEVAILCAGKEGR
    AGLDDLYTAGVLAEYLGFLGEVEPEDGARVALAVKRAYPDPLEALSLSAAALALKQVGLEADVPFCAQVAKSA
    AVPVLRGRVGEALIFKRA