Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

2yys

2yys (red) and 1uk7 (white)

PDBID: 2yys

Motif: 1uk7

EC # of Motif: 3.7.1.9
 
Motif Homolog: N/A

Levenshtein Distance: 0-3

RMSD All: 1.6644 Å

RMSD CA1.4669 Å

RMSD CA+CB1.5759 Å

Residues: (3)

2yys1uk7 
 Ala-126Ala-103 
Asp-229 Asp-224 
His-255 His-252 

2yys FASTA: 
    MREEIGYVPVGEAELYVEDVGPVEGPALFVLHGGPGGNAYVLREGLQDYLEGFRVVYFDQRGSGRSLE
    LPQDPRLFTVDALVEDTLLLAEALGVERFGLLAHGFGAVVALEVLRRFPQAEGAILLAPWVNFPWLAA
    RLAEAAGLAPLPDPEENLKEALKREEPKALFDRLMFPTPRGRMAYEWLAEGAGILGSDAPGLAFLRNGL
    WRLDYTPYLTPERRPLYVLVGERDGTSYPYAEEVASRLRAPIRVLPEAGHYLWIDAPEAFEEAFKEALAA
    LVPALRGPLVD