Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

2ywo

2ywo (red) and 1e2t (white)


PDBID: 2ywo

Motif: 1e2t

EC # of Motif: 2.3.1.118
 
Motif Homolog: N/A

Levenshtein Distance: 0

RMSD All: 1.6644 Å

RMSD CA1.4669 Å

RMSD CA+CB1.5759 Å

Residues: (3)

2ywo  1e2t
 Cys-42 Cys-69
His-44  His-107
Asp-82  Asp-122


2ywo FASTA:
    MLQYPELPLESPLIDAELPDPRGGRYRLSQFHEPLLAVVFMCNHCPYVKGSIGELVALAERYRGKVAFVGI
    NANDYEKYPEDAPEKMAAFAEEHGIFFPYLLDETQEVAKAYRALRTPEVFLFDERRLLRYHGRVNDNPK
    DPSKVQSHDLEAAIEALLRGEEPPLKEAPAIGCTIKWRPGNEPEVRIG