Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

2xu2


2xu2 (red) and 1bmt (white)


PDBID: 2xu2

Motif: 1bmt

EC # of Motif: 2.1.1.13
 
Motif Homolog: N/A

Levenshtein Distance: 0

RMSD All: 1.5233 Å

RMSD CA2.2331 Å

RMSD CA+CB1.994 Å

Residues: (3)

 2xu21bmt
Asp-176 Asp-757
 His-232 His-759
 Ser-238Ser-810


2zu2 FASTA: 
    GANDTGRRILLNCDMGESFGAWRMGDDVHSMPLVDQANLACGFHAGDPLTMRRAVELAVRHGVSIGAHPAYPDLS
    GFGRRSLACSAEEVHAMVLYQIGALDAFCRSLGTQVAYVKPHGALYNDLVGDDELLRAVLDACAAYRKGLPLMVLA
    LADNGRELELADEADVPLLFEAFADRAYLPDGRLAPRRLGGAVHHDPQRIIEQALAIARGEAFPDYDGNPLRLTADSLC
    VHGDNPQSLAVLRRLRAALDSL