Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

2r8b

2r8b (red) and 1azw (white)


PDBID: 2r8b

Motif: 1azw

EC # of Motif: 3.4.11.5
 
Motif Homolog: 1xqw

Levenshtein Distance: 0-3

RMSD All: 0.3357 Å

RMSD CA0.2271 Å

RMSD CA+CB0.251 Å

Residues: (3)

 2r8b1azw 
 Ser-147 Ser-110
Asp-197  Asp-266
His-228  His-294



2r8b (red) and 1tah (white)


Motif: 1tah

EC # of Motif: 3.1.1.33
 
Motif Homolog: 1qd6, 1r4z

Levenshtein Distance: 0-3

RMSD All: 0.3013 Å

RMSD CA0.0393 Å

RMSD CA+CB0.34 Å

Residues: (3)

 2r8b 1tah
 Ser-147 Ser-87
Asp-197 Asp-263
 His-228 His-285


2r8b FASTA: 
    GHMPRPSLRRGEETSGARSLHEIAPPAEKAVRKPLNLLPFRKDTPMTKDSYFHKSRAGVAGAPLFVLL
    HGTGGDENQFFDFGARLLPQATILSPVGDVSEHGAARFFRRTGEGVYDMVDLERATGKMADFIKA
    NREHYQAGPVIGLGFSNGANILANVLIEQPELFDAAVLMHPLIPFEPKISPAKPTRRVLITAGERDPIC
    PVQLTKALEESLKAQGGTVETVWHPGGHEIRSGEIDAVRGFLAAYGGGS