Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

2r85


2r85 (red) and 1pn1 (white)

PDBID: 2r85

Motif: 1pn1

EC # of Motif: 3.5.1.11
 
Motif Homolog: 3pva

Levenshtein Distance: 0-3

RMSD All: 1.9436 Å

RMSD CA0.3918 Å

RMSD CA+CB1.3334 Å

Residues: (3)

 2r851pn1 
 Ser-12Ser-1 
Ala-290 Ala-69 
Asn-293  Asn-241

2r85 FASTA:
    MKVRIATYASHSALQILKGAKDEGFETIAFGSSKVKPLYTKYFPVADYFIEEKYPEEELLNLNAVVVPTGSFV
    AHLGIELVENMKVPYFGNKRVLRWESDRNLERKWLKKAGIRVPEVYEDPDDIEKPVIVKPHGAKGGKGYF
    LAKDPEDFWRKAEKFLGIKRKEDLKNIQIQEYVLGVPVYPHYFYSKVREELELMSIDRRYESNVDAIGRIPAK
    DQLEFDMDITYTVIGNIPIVLRESLLMDVIEAGERVVKAAEELMGGLWGPFCLEGVFTPDLEFVVFEISARIV
    AGTNIFVNGSPYTWLRYDRPVSTGRRIAMEIREAIENDMLEKVLT