Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

2q4k

2q4k (red) and 1od1 (white)

PDBID: 2q4k

Motif: 1od1

EC # of Motif: 3.4.23.22
 
Motif Homolog: 1eed

Levenshtein Distance: 1-5

RMSD All: 2.0768 Å

RMSD CA1.5888 Å

RMSD CA+CB1.497 Å

Residues: (3)

 2q4k1od1 
  Asp-35
 Ser-126 Ser-38
Asp-178 Asp-219 
 Thr-180 Thr-222

2q4k FASTA:
    MEPGEELEEEGSPGGREDGFTAEHLAAEAMAADMDPWLVFDARTTPATELDAWLAKYPPSQVTRYGDPGSPNSEP
    VGWIAVYGQGYSPNSGDVQGLQAAWEALQTSGRPITPGTLRQLAITHHVLSGKWLMHLAPGFKLDHAWAGIARA
    VVEGRLQVAKVSPRAKEGGRQVICVYTDDFTDRLGVLEADSAIRAAGIKCLLTYKPDVYTYLGIYRANRWHLCPTL
    YESRFQLGGSARGSRVLDRANNVELT