Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

2q4d

2q4d (red) and 1ajo (white)

PDBID: 2q4d

Motif: 1ajo

EC # of Motif: 3.2.1.73
 
Motif Homolog: N/A

Levenshtein Distance: 1-6

RMSD All: 1.786 Å

RMSD CA1.1366 Å

RMSD CA+CB0.7065 Å

Residues: (3)

2q4d 1ajo 
  
  
  


2q4d (red) and 1uk7 (white)

Motif: 1uk7

EC # of Motif: 3.7.1.9
 
Motif Homolog: N/A

Levenshtein Distance: 1-2

RMSD All: 1.6818 Å

RMSD CA0.33269 Å

RMSD CA+CB0.6471 Å

Residues: (3)

 2q4d 1uk7
 Chain A Chain A
 Asp-94 Ala-103
Asp-224  Asp-224
 Chain B Chain A
 Ala-100 His-252



2q4d FASTA:
    SEDNQRSRFRKICVFCGSHSGHREVFSDAAIELGNELVKRKIDLVYGGGSVGLMGLISRRVYEGGLHVLGIIP
    KALMPIEISGETVGDVRVVADMHERKAAMAQEAEAFIALPGGYGTMEELLEMITWSQLGIHKKTVGLLNVD
    GYYNNLLALFDTGVEEGFIKPGARNIVVSAPTAKELMEKMEEYTPSHMHVASHESWKVEELGDYPGQENKPQ