Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

2pw6

2pw6 (red) and 1iph (white)

PDBID: 2pw6

Motif: 1iph

EC # of Motif: 1.11.1.6
 
Motif Homolog: 1o9i

Levenshtein Distance: 0

RMSD All: 1.8186 Å

RMSD CA1.7931 Å

RMSD CA+CB1.6688 Å

Residues: (3)

2pw6 1iph 
His-22 His-128 
Ser-172 Asn-201 
Asn-174 His-392 


2pw6 FASTA: 
    MTPLVKDIIMSSTRMPALFLGHGSPMNVLEDNLYTRSWQKLGMTLPRPQAIVVVSAHWFTRGTGVTAMETPPTIH
    DFGGFPQALYDTHYPAPGSPALAQRLVELLAPIPVTLDKEAWGFDHGSWGVLIKMYPDADIPMVQLSIDSSKPAAW
    HFEMGRKLAALRDEGIMLVASGNVVHNLRTVKWHGDSSPYPWATSFNEYVKANLTWQGPVEQHPLVNYLDHEG
    GTLSNPTPEHYLPLLYVLGAWDGQEPITIPVEGIEMGSLSMLSVQIG