Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

2p0v

2p0v (red) and 1aam (white)

PDBID: 2p0v

Motif: 1aam

EC # of Motif: 2.6.1.1
 
Motif Homolog: 1xff, 1jxa

Levenshtein Distance: 0-3

RMSD All: 1.9599 Å

RMSD CA2.4449 Å

RMSD CA+CB2.2802 Å

Residues: (3)

 2p0v1aam 
 Trp-161Trp-142 
 Asp-164Asp-223 
 Lys-176Lys-258 

2p0v FASTA:
    MNITKTLCLCAALSGAAGVQAMENREFVTQQDNTRVNNYQTNRPEASKRLFVSQEVERQIDHIKQLLTNAKLAWM
    FENCFPNTLDTTVHFDGKEDTFVYTGDIHAMWLRDSGAQVWPYVQLANKDPELKKMLAGVINRQFKCINIDPYAN
    AFNMNSEGGEWMSDLTDMKPELHERKWEIDSLCYPIRLAYHYWKTTGDASVFSDEWLQAIANVLKTFKEQQRKDDA
    KGPYRFQRKTERALDTMTNDGWGNPVKPVGLIASAFRPSDDATTFQFLVPSNFFAVTSLRKAAEILNTVNRKPALAK
    ECTALADEVEKALKKYAVCNHPKYGKIYAFEVDGFGNQLLMDDANVPSLIALPYLGDVKVTDPIYQNTRKFVWSED
    NPYFFKGSAGEGIGGPHIGYDMIWPMSIMMKAFTSQNDAEIKTCIKMLMDTDAGTGFMHESFNKNDPKNFTRAWFA
    WQNTLFGELILKLVNEGKVDLLNSIQLEHHHHHH