Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

2p0o

2p0o (red) and 1k9z (white)

PDBID: 2p0o

Motif: 1k9z

EC # of Motif: 3.1.3.7
 
Motif Homolog: 1qgx

Levenshtein Distance: 0

RMSD All: 0.9305 Å

RMSD CA0.6449 Å

RMSD CA+CB0.9513 Å

Residues: (3)

 2p0o1k9z 
 Asp-178Asp-49 
 Thr-227 Thr-147
 Asp-339 Asp-294

2p0o FASTA:
    SNAMYGISVFLGEEITNDTIIYIKKMKALGFDGIFTSLHIPEDDTSLYRQRLTDLGAIAKAEKMKIMVDISGEALKRAGFS
    FDELEPLIELGVTGLRMDYGITIEQMAHASHKIDIGLNASTITLEEVAELKAHQADFSRLEAWHNYYPRPETGIGTTFFN
    EKNRWLKELGLQVFTFVPGDGQTRGPIFAGLPTLEKHRGQNPFAAAVGLMADPYVDAVYIGDPTISERTMAQFGYYH
    QTNQFLLEVAPSESRYLKRILGTHTNRLDAARDVLRSELSRTSEMFRKDEIATIESEQTEARPVGTVTIDNEKYGRYMGE
    IQVTLVDLPKDEKVNTITRIIDKDQTILPLIKAGNQFTLVTEGTIENEFRKLNN