Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

2o14


PDBID: 2o14

Motif: 1bwr

EC # of Motif: 3.1.1.47
 
Motif Homolog: 1bwp

Levenshtein Distance: 0

RMSD All: 0.578 Å

RMSD CA0.5064 Å

RMSD CA+CB0.7125 Å

Residues: (5)

2o14 1bwr 
 Ser-171Ser-47 
 Gly-209 Gly-74
 Asn-241 Asn-104
 Asp-339 Asp-192
 His-342 His-195

                                                            2o14 (red) and 1bwr




Motif: 1azw

EC # of Motif: 3.4.11.5
 
Motif Homolog: 1xqw

Levenshtein Distance: 0

RMSD All: 2.3507 Å

RMSD CA1.0499 Å

RMSD CA+CB1.386 Å

Residues: (3)

 2o141azw 
 Ser-171 Ser-110
Asp-339  Asp-266
His-342  His-294





                                                            2o14 (red) and 1azw (white)


2o14 FASTA: 
    MFGGIENVKAAEPKVYQFDFGSGSMEPGYIGVRASDRYDRSKGYGFQTPENMRDVAASGAGVKSDAVE
    FLAYGTKSNNTFNVDLPNGLYEVKVTLGNTARASVAAEGVFQVINMTGDGAEDTFQIPVTDGQLNLLV
    TEGKAGTAFTLSALKIKKLSDQPVTNRTIYVGGDSTVCNYYPLNSSKQAGWGQMLPHYIDKHTFQVRNM
    ASGGQIARGFRNDGQLEAILKYIKPGDYFMLQLGINDTNPKHKESEAEFKEVMRDMIRQVKAKGADVILS
    TPQGRATDFTSEGIHSSVNRWYRASILALAEEEKTYLIDLNVLSSAYFTSIGPERTLGLYMDGDTLHPNRAG
    ADALARLAVQELKRQGIAGFLEHHHHHH