Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

2kfl

2kfl (red) and 1moq (white)

PDBID: 2kfl

Motif: 1moq

EC # of Motif: 2.6.1.16
 
Motif Homolog: 1xff, 1jxa

Levenshtein Distance: 1

RMSD All: 0.341 Å

RMSD CA0.2844 Å

RMSD CA+CB0.2883 Å

Residues: (3)

2kfl 1moq 
Glu-200 Glu-481 
 Lys-204Lys-484 
 Glu-207Glu-488 


2kfl FASTA:
    GSVVGGLGGYMLGSAMSRPVMHFGNEYEDRYYRENQYRYPNQVMYRPIDQYGSQNSFVHDCVNITVKQHT
    TTTTTKGENFTETDIKIMERVVEQMCITQYQNEYQAAQRYYN