Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

2i3d


2i3d (red) and 1c4x (white)

PDBID: 2i3d

Motif: 1c4x

EC # of Motif: 3.7.1.8
 
Motif Homolog: N/A

Levenshtein Distance: 0-3

RMSD All: 0.3825 Å

RMSD CA0.2808 Å

RMSD CA+CB0.3376 Å

Residues: (3)

2i3d 1c4x 
 Ser-108 Ser-110
Asp-157  Asp-235
His-190  His-263



2i3d (red) and 1azw (white)

Motif: 1azw

EC # of Motif: 3.4.11.5
 
Motif Homolog: 1xqw

Levenshtein Distance: 0-3

RMSD All: 0.51 Å

RMSD CA0.347 Å

RMSD CA+CB0.3029 Å

Residues: (3)

 2i3d1azw 
 Ser-108Ser-110 
 Asp-157Asp-266 
 His-190 His-294


2i3d FASTA:
    MGSSHHHHHHSSGRENLYFQGHMPEVIFNGPAGRLEGRYQPSKEKSAPIAIILHPHPQFGGTMNNQI
    VYQLFYLFQKRGFTTLRFNFRSIGRSQGEFDHGAGELSDAASALDWVQSLHPDSKSCWVAGYSFGA
    WIGMQLLMRRPEIEGFMSIAPQPNTYDFSFLAPCPSSGLIINGDADKVAPEKDVNGLVEKLKTQKGILI
    THRTLPGANHFFNGKVDELMGECEDYLDRRLNGELVPEPAAKRIRGS