Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

2i1s

2i1s (red) and 2xis (white)

PDBID: 2i1s

Motif: 2xis

EC # of Motif: 5.3.1.5
 
Motif Homolog: N/A

Levenshtein Distance: 1-3

RMSD All: 2.4596 Å

RMSD CA2.8601 Å

RMSD CA+CB2.6042 Å

Residues: (4) 

2i1s 2xis 
 Chain AChain A 
 His-51His-54 
Asp-106  Asp-57
 Chain BChain A 
 Lys-12 Glu-181
 Lys-114 Lys-183


2i1s FASTA:
     MKKTFEKVYHLKLSIKGITPQIWRRIQVPENYTFLDLHKAIQAVMDWEDYHLHEFEMVNPKTGMLDKIGAEGD
    DFDAFGGPLVSEKKAKLSDYFTLENKEALYTYDFGDNWQVKVRLEKILPRKEGVEYPICTAGKRAAVPEDSGGV
    WGYEEMLEVLKDSEHEEYEDTVLWLGDDFDPEYFDPKDVSF