Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

2gge

PDBID: 2gge

Motif: 1uag

EC # of Motif: 6.3.2.9
 
Motif Homolog: 2uag

Levenshtein Distance: 0-22

RMSD All: 1.92849 Å

RMSD CA0.8205 Å

RMSD CA+CB1.15245 Å

Residues: (3)

 2gge 1uag
 Lys-161 Lys-115
Asn-192  Asn-138
His-293  His-183
                                                            
2gge (red) and 1uag (white)







Motif: 2uag

EC # of Motif: 6.3.2.9
 
Motif Homolog: 1uag

Levenshtein Distance: 0-21

RMSD All: 2.00267 Å

RMSD CA0.8451 Å

RMSD CA+CB1.2206 Å

Residues: (3)  

  2gge     
 2uag
 Lys-161 Lys-115
 Asn-192 Asn-138
 His-293 His-183



                                        2gge (red) and 2uag (white)


2gge FASTA:
    MALVKIVRIETFPLFHRLEKPYGDANGFKRYRTCYLIRIITESGIDGWGECVDWLPALHVGFTKRIIPFLLGKQ
    AGSRLSLVRTIQKWHQRAASAVSMALTEIAAKAADCSVCELWGGRYREEIPVYASFQSYSDSPQWISRSVS
    NVEAQLKKGFEQIKVKIGGTSFKEDVRHINALQHTAGSSITMILDANQSYDAAAAFKWERYFSEWTNIGW
    LEEPLPFDQPQDYAMLRSRLSVPVAGGENMKGPAQYVPLLSQRCLDIIQPDVMHVNGIDEFRDCLQLAR
    YFGVRASAHAYDGSLSRLYALFAQACLPPWSKMKNDHIEPIEWDVMENPFTDLVSLQPSKGMVHIPKGK
    GIGTEINMEIVNRYKWDGSAYEGHHHHHH