Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

2gfq

2gfq (red) and 1d6o (white)

PDBID: 2gfq

Motif: 1d6o

EC # of Motif: 5.2.1.8
 
Motif Homolog: 1m9c, 1nmw

Levenshtein Distance: 0-4

RMSD All: 2.43705 Å

RMSD CA1.77081 Å

RMSD CA+CB1.5437 Å

Residues: (3)  

 2gfq1d6o 
Asp-43 Asp-37 
Ile-73 Ile-56 
Tyr-182 Tyr-82 


2gfq FASTA:
    MGSSHHHHHHSSGRENLYFQGHMKVIMTTKVDKASMNIMNKLIENFGFKETEYVFEGNPVYKRGDVLILTTND
    EMIYYDYLDREIENQLGFKPEIIAFASRHSSKQKLPALTTHVTGNWGKAMYGGKDESFAVAIPSAMKLSLLKMSEL
    NDLGWTVCYEATHHGPTELEVPSFFIEIGSSEEEWINDRAGEIIAETIIYVLDNYEKGRSKFKVALGIGGGHYAPKQ
    TKRALEGDLAFGHILPKYAQPVSRDVMIKALNRFGEKVEAIYVDWKGSRGETRQLAKSLAQELGLEFIKDGS