Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

2g6t

2g6t (red) and 1naa (white)


PDBID: 2g6t

Motif: 1naa

EC # of Motif: 1.1.99.18
 
Motif Homolog: N/A

Levenshtein Distance: 0

RMSD All: 2.1291 Å

RMSD CA2.6651 Å

RMSD CA+CB2.347 Å

Residues: (3)

 2g6t1naa 
 Asn-189Asn-732 
His-142 His-689 
Tyr-140 Tyr-609 


2g6t FASTA:
    MYKCLIWGVNDEYTLAYDKLLFEISKGNLSIEALISKDKYAKYIDGKEVIDKTEISNYEFDYIIIFNKERYS
    DIKNEALELGIPERKILNGKFFFISNFDFKRYCKLIENPITIISDDCWGGLVSSYLGFKFNSPFINFYIHND
    DYIKFLENMDYYLEQELKVEQEGNVYSCTMPKGSLGTGDNKIILNFNHQASFAEAKNDWDERKTRIN
    KKNLFVKMLIKDDNEKLVKRFDNLPYKNKVCFHPKPMKYKSVAFFPRYIWRCINYAARTSNSNLEQY
    TMDMSWLEKSCDILKMLCGEEDFIREKX