Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

2fbm

2fbm (red) and 1aw5


PDBID: 2fbm

Motif: 1aw5

EC # of Motif: 4.2.1.24
 
Motif Homolog: 1h7o

Levenshtein Distance: 1

RMSD All: 2.4349 Å

RMSD CA1.3257 Å

RMSD CA+CB1.609 Å

Residues: (3)

 2fbm1aw5 
Asp-327 Asp-131 
Ser-329 Ser-179 
Lys-381 Lys-210 


2fbm FASTA:
    MGSSHHHHHHSSGLVPRGSSTYRDIVVKKEDGFTQIVLSTRSTEKNALNTEVIKEIVNALNSAAADD
    SKLVLFSAAGSVFCCGLDFGYFVKHLRNNRNTASLEMVDTIKNFVNTFIQFKKPIVVSVNGPAIGLGA
    SILPLCDLVWANEKAWFQTPYTTFGQSPDGCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVS
    QVFLTGTFTQEVMIQIKELASYNPIVLEECKALVRCNIKLELEQANERECEVLRKIWSSAQGIESMLKIPL
    LGYKAAFPPRKTQNDQRW