Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

2f06


2f06 (red) and 1dhr (white)

PDBID: 2f06

Motif: 1dhr

EC # of Motif: 1.5.1.34
 
Motif Homolog: 1dir, 1ooe

Levenshtein Distance: 0-3

RMSD All: 1.886635 Å

RMSD CA4.28438 Å

RMSD CA+CB3.700655 Å

Residues: (3)  

 2f061dhr 
 Tyr-56Tyr-146 
Lys-60 Lys-150 
Asn-67  Asn-186

2f06 FASTA:
    SNAMVAKQLSIFLENKSGRLTEVTEVLAKENINLSALCIAENADFGILRGIVSDPDKAYKALKDNHFAVNITD
    VVGISCPNVPGALAKVLGFLSAEGVFIEYMYSFANNNVANVVIRPSNMDKCIEVLKEKKVDLLAASDLYKL