Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

2dec



PDBID: 2dec

Motif: 1pzp

EC # of Motif: 3.5.2.6
 
Motif Homolog: 1btl1m6k

Levenshtein Distance: 0-3

RMSD All: 3.045674 Å

RMSD CA3.98608 Å

RMSD CA+CB3.681289 Å

Residues: (4)

2dec  1pzp
 Chain A Chain A
 Ser-206Ser-70 
 Lys-210 Lys-73
Ser-217  Ser-130
 Chain B Glu-166
 Glu-218 

2dec (red) and 1nyy (white)

Motif: 1nyy

EC # of Motif: 3.5.2.6
 
Motif Homolog: 1btl, 1m6k

Levenshtein Distance: 0-3

RMSD All: 3.080454 Å

RMSD CA4.05036 Å

RMSD CA+CB3.72744 Å

Residues: (4)

 2dec 1nyy
 Chain A Chain A
 Ser-206Ser-70 
Lys-210 Lys-73 
Ser-217 Ser-130 
Chain B Chain A 
 Glu-218Glu-166 


2dec FASTA:
    MKTLIEIKQTPDGIIKADKVFNKVKDKISLPNRILYLGCGSSHFLSKLLAMVTNMHGGLGIALPCSEFLYSKE
    TYPIGEVELAVGISRSGETTEILLALEKINVKKLGITTRESSLTRMCDYSLVVPAIEESVVMTHSFTSFYFAYL
    QLLRYSYGLPPLNAGEISKATEKSLEYERYIREIVESFDFQNIIFLGSGLLYPVALEASLKMKEMSIFWSEAYP
    TFEVRHGFKAIADEKTLVVLMVEEPFEWHEKLVKEFKNQGAKVLVISNSPQDLGQDYSIELPRLSKDANP
    IPYLPIVQLLSYYKAVSRGLNPDNPRFLDKVVRW