Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

2dc4

2dc4 (red) and 3csm (white)

PDBID: 2dc4

Motif: 3csm

EC # of Motif: 5.4.99.5
 
Motif Homolog: 1dbf

Levenshtein Distance: 0-4

RMSD All: 5.198 Å

RMSD CA2.83277 Å

RMSD CA+CB3.03615 Å

Residues: (4)

2dc4 3csm 
Arg-45  Arg-16
Arg-47  Arg-157
 Lys-60 Lys-168
 Arg-102 Glu-246


2dc4 FASTA:
     MEIEVKFRVNFEDIKRKIEGLGAKFFGIEEQEDVYFELPSPKLLRVRKINNTGKSYITYKEILDKRNEEFYELEFEVQ
    DPEGAIELFKRLGFKVQGVVKKRRWIYKLNNVTFELNRVEKAGDFLDIEVITSNPEEGKKIIWDVARRLGLKEED
    VEPKLYIELING