Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

2dbi

2dbi (red) and 1bp2 (white)

PDBID: 2dbi

Motif: 1bp2

EC # of Motif: 3.1.1.4
 
Motif Homolog: 1bwp, 1cjy

Levenshtein Distance: 1

RMSD All: 2.286378 Å

RMSD CA1.91719 Å

RMSD CA+CB1.7546006 Å

Residues: (3)

 2dbi1bp2
 Gly-201 Gly-30
His-203  His-48
Asp-205  Asp-99
His-345  


2dbi FASTA:
    MKDHLIHNVHKEEHAHAHNKDYDIPTTENLYFQGSSGSSGMASTFTSDTLPADHKAAIRQMKHALRAQLGDVQ
    QIFNQLSDDIATRVAEINALKAQGDAVWPVLSYADIKAGHVTAEQREQIKRRGCAVIKGHFPREQALGWDQSMLD
    YLDRNRFDEVYKGPGDNFFGTLSASRPEIYPIYWSQAQMQARQSEEMANAQSFLNRLWTFESDGKQWFNPDVSVI
    YPDRIRRRPPGTTSKGLGAHTDSGALERWLLPAYQRVFANVFNGNLAQYDPWHAAHRTEVEEYTVDNTTKCSVF
    RTFQGWTALSDMLPGQGLLHVVPIPEAMAYVLLRPLLDDVPEDELCGVAPGRVLPVSEQWHPLLIEALTSIPKLEAG
    DSVWWHCDVIHSVAPVENQQGWGNVMYIPAAPMCEKNLAYAHKVKAALEKGASPGDFPREDYETNWEGRFTLA
    DLNIHGKRALGMDV